Protein Info for PP_2668 in Pseudomonas putida KT2440

Annotation: ABC efflux transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR03864: ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system" amino acids 3 to 237 (235 residues), 349.8 bits, see alignment E=3.5e-109 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 99.5 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3095)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JI1 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PP_2668 ABC efflux transporter, ATP-binding protein (Pseudomonas putida KT2440)
MNALDVSDVSFAYGQREALRQVGFSLAPGRFAALLGPNGAGKSTLIALLTRLYDLQRGDI
RVCGCSLRNAARPALRQLGVVFQQSTLDLDLSVEQNLRYHAALHGLSRRQSHLRVEAELA
RQGLGERRRDRVRELNIGHRRRVEIARALLHEPRLLLLDEASVGLDPASRLALNQHLRRL
CREQQLSVLWATHLLDEVQPSDDLLILHQGRLVASGTADALSLEHGGDLDHAFARLTNAP
SGANAR