Protein Info for PP_2667 in Pseudomonas putida KT2440

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details TIGR03861: alcohol ABC transporter, permease protein" amino acids 5 to 257 (253 residues), 485.3 bits, see alignment E=2.1e-150 PF01061: ABC2_membrane" amino acids 11 to 225 (215 residues), 115.2 bits, see alignment E=4.6e-37 PF12698: ABC2_membrane_3" amino acids 62 to 249 (188 residues), 61.4 bits, see alignment E=1.3e-20 PF12679: ABC2_membrane_2" amino acids 73 to 253 (181 residues), 27.2 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to ppf:Pput_3096)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JI2 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PP_2667 ABC transporter (Pseudomonas putida KT2440)
MNAYWQCFNGIMLREWLRFVLQRTRLLSALVRPLLWLLVFAAGFRAALGIAIIEPYDTYI
PYEVYIIPGLACMILLFNGMQGSLSMVYDREMGSMRVLLTSPLPRPFLLGSKLLATSLIS
LLQVYAFLAIAWLYGVQPPAAGLLMALPALLLVAFMLSALGLLLSNAIRQLENFAGVMNF
VIFPLFFLSSALYPLWKMREASQWLYWLCAVNPFTHAVELVRFALYERLNLLALAVCLGL
TALFTLLAILTFNPQHAALRKPR