Protein Info for PP_2664 in Pseudomonas putida KT2440

Annotation: putative hybrid sensor and regulator, histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 97 to 215 (119 residues), 40.4 bits, see alignment E=1.5e-14 PF08448: PAS_4" amino acids 102 to 209 (108 residues), 95.3 bits, see alignment E=6.9e-31 PF00512: HisKA" amino acids 268 to 332 (65 residues), 42.5 bits, see alignment E=1.4e-14 PF02518: HATPase_c" amino acids 377 to 486 (110 residues), 74.5 bits, see alignment E=2.3e-24 PF00072: Response_reg" amino acids 511 to 622 (112 residues), 41.1 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2664)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JI5 at UniProt or InterPro

Protein Sequence (632 amino acids)

>PP_2664 putative hybrid sensor and regulator, histidine kinase (Pseudomonas putida KT2440)
MPATGLLSVAELQAELTRLQHQNHKLQRINDALIERIESGVTRGNDPYAAFQHSVVLAEQ
VRERTDALNQAMAELKAVNRLLSEARQRAETAHQHQIRLITDNVPALIAYLNADLVYEFT
NKVYEEWYCWPHGVMLGQSLREAHSEQHYQRLEGYVARALAGESVTFEFAETNINGQERY
MLRSYVPNRLASGEVVGIFVLIRDITERRNTAQALHQAYQHLEQRVRERTAELTSLNDQL
LREIEERSQAESRLREAKREAEQANLSKTKFLAAVSHDLLQPLNAARLFTSALLERDEPQ
NAAHLVRNVSNSLEDVENLLGTLVDISKLDAGVIKADVAPFALHELMDNLAAEYVQVARS
EGLELHFVGCSAVVRSDIQLLARILRNLLSNAIRYTPSGRVVLGCRRLRGGVRIEVWDSG
IGIAEEHLQDMFLEFKRGDVQRPDQDRGLGLGLAIVEKIAGILGHRIRVRSWLGKGSVFA
VEVPLSTTAPKAQPSQVICEPMLERLRGARVWVLDNDAAICAGMRTLLEGWGCRVVTALS
EEDLARQVDNYHADADLLIADYHLDNDCNGVDAVARINARRAQPLPALMITVNYSNDLKQ
QIRELGHTLMHKPVRPMKLKTAMSHLLASGLA