Protein Info for PP_2647 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 342 (313 residues), 113.9 bits, see alignment E=8.1e-37 PF00083: Sugar_tr" amino acids 32 to 199 (168 residues), 28.9 bits, see alignment E=5.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_2152)

Predicted SEED Role

"Transcription regulatory protein opdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JK2 at UniProt or InterPro

Protein Sequence (408 amino acids)

>PP_2647 Major facilitator family transporter (Pseudomonas putida KT2440)
MPSNSQAPRGLPEHSQQSVTQQWLAILSVAVGAFALVTSEFLPVGVLNDVASDLGISAGL
AGLMVTLPGIMAALAAPLISVGVGALDRRYLLIGLTLIMIIANAIVAYAGDFNLLLVGRV
LLGISIGGFWATAIALSGRLAPDGMGVAKANSIIMAGVTLATVVGVPVGTWLSGLMGWRM
TFLVTALVGVPVLLAQVFLLPRLMPEKAIRIRDLPALFINPQARVGLIAVLLIGLAHFAA
YTYVAPFFKQNAGFDGPTIGSLLLLYGVAGFMGNIFAGFAANRSVRHTLMLVALMIAVST
ALFPHFATGMTGAAMLIALWGFAFGAFPACANIWMFVVAPKDVERGMPLFVAMFQVIIAV
GSFFGGQVVDHMGTAVLLSLATALVGCGFVTVLVLGRNVSNDLAAQPG