Protein Info for PP_2628 in Pseudomonas putida KT2440

Annotation: Uncharacterized ABC transporter ATP-binding protein HI_1051

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 transmembrane" amino acids 79 to 103 (25 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 337 to 354 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 80 to 348 (269 residues), 71.3 bits, see alignment E=1.1e-23 PF00005: ABC_tran" amino acids 418 to 572 (155 residues), 120.5 bits, see alignment E=8.4e-39

Best Hits

Swiss-Prot: 60% identical to Y1051_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1051 (HI_1051) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to ppu:PP_2628)

Predicted SEED Role

"Multidrug resistance ABC transporter ATP-binding and permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JM1 at UniProt or InterPro

Protein Sequence (658 amino acids)

>PP_2628 Uncharacterized ABC transporter ATP-binding protein HI_1051 (Pseudomonas putida KT2440)
MSCKGLLTNTPRPTFSGLKTTVGKGKPAGHWPSKNRFPETSMLRIFERRLDPFPPDEVPP
PPVGLLRFMWACTRGARGYILALALLSAGVSIYEAWLFAFLGQVVDLLASWQAGGTVGPE
ESRVLWGIGIVLVVSIGLVALRTMVQHQVLAINLPLRLRWDFHRLMLRQSLSFFSDEFSG
RVTTKVMQTALAVRDVLFTLIEILPGIGVYFIAIIALAGGFALKLMLPFIAWVVLFGLAM
LYFVPRLGKVGQEQANARSSMTGRVSDAYTNITTVKLFSHSNREAHFARAAMEDFKQTGF
RQMRLVSQFEIVNQALVVGLIFGAGGYALWLWHQGQVGTGAVAAITAMALRVNGMSHWIM
WEITSLFENIGTVQDGMATLTRGPKVQDVPGAAELVTTGGAVSFDKVSFNYNGERQVLNE
LTLHIRPGEKVGLVGRSGAGKSTLINLLLRFYDVDKGEIRIDGQNVAKVTQDSLRSAIGM
VTQDTSLLHRSIRDNIAYGRPDATEAQIRAAAASAQADGFISQLSDRQGNSGYDTLVGER
GIKLSGGQRQRIAIARVMLKNAPILLLDEATSALDSEVEVAIQESLDEMMQGKTVIAIAH
RLSTIAAMDRLIVMDEGRIIEQGTHAELLAKKGTYARLWQHQSGGFLGEDQGVAEAVE