Protein Info for PP_2617 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR03353: type VI secretion protein, VC_A0114 family" amino acids 5 to 443 (439 residues), 534.8 bits, see alignment E=7.8e-165 PF05936: T6SS_VasE" amino acids 19 to 442 (424 residues), 505.9 bits, see alignment E=4.6e-156

Best Hits

KEGG orthology group: K11893, type VI secretion system protein ImpJ (inferred from 100% identity to ppu:PP_2617)

Predicted SEED Role

"Uncharacterized protein ImpJ/VasE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JN2 at UniProt or InterPro

Protein Sequence (445 amino acids)

>PP_2617 conserved protein of unknown function (Pseudomonas putida KT2440)
MSSRNPVLWPEGLFVKPQHFQQAARASEAALHQRLASLNAAFYGFSELQLNDEYLSLGKV
AITRARGVMPDGTVFDIPADLPPPPPLEIGDDACQDSEVYLCLPLRTDGGREVSWPDNAA
NFRYTAQVQEIKDTHSADGDLVQVDLAVPNLQLKRKTEDSSAYTRLALARILERRPDGSL
QLDEAFYPTSVSVRAVPALQRFLEEITHTLRERARGLATRIGASGQSGIADIRDFNLLQA
MNRWWPCFQHLARQAQTHPEQLYLCMSQACGEFVTFTDQNRLPQEYPAYHHTALRTSFKP
LEDTLRRSLSTVLRPRAVSLPLESEQFGVMTTTLEDRRLIDEADFILAVRASMPPQALRQ
MFIQKAKITSLESLNDLVPLQLPGIPLLPLPVAPRDLPFHAGFSYFELDRRDPAWACMSK
ANGFGIHIAGDFPGLELQFWAIRSE