Protein Info for PP_2595 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 55 to 262 (208 residues), 37.4 bits, see alignment E=3.7e-13 PF00005: ABC_tran" amino acids 350 to 499 (150 residues), 103.4 bits, see alignment E=2.4e-33

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to ppu:PP_2595)

Predicted SEED Role

"Putative ABC iron siderophore transporter, fused permease and ATPase domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JQ4 at UniProt or InterPro

Protein Sequence (585 amino acids)

>PP_2595 putative ABC transporter, permease/ATP-binding protein (Pseudomonas putida KT2440)
MLKTFVRLLGECAPAWRRYLLMTVLYGVFSGLTISTLAPLMLHLLNSEIHAASAWLVVLA
AGLTLCWAWRRQVEKAGISLAVAVLQGGRQHIGAQVAQLPLGWFTPDNTARLGHVITQGT
MAVAQLPAHVLTPLISSSVTPLVLLVALFILHPPLGLVALLALPALAAVLLFSARLGRRA
DHAFHQHFAAASQRMVEFAQAQSVLRAFNGEGGGTRLLAQSLERQRSSGMGLIIRASLSA
LLNSWAVQATFAALLVAAGLWFGDQAGGQAQDAVAVIVALVLVCRFIDPLQDVASHVEIL
RGAHGQLQEIERILAAKPLPEPASPHRPVGGAINLQGVSLRYNPTGPDVLQNVNLHIPAG
SMTAVIGASGSGKTSLMRLIARFFDTTEGSVRIGGVDVRQMARASLTDTVSQVLQDTWLF
QGSIADNIRIGKPDASDAEVLQAAHMAGLGHTLERLRGGLDTSVGEGGAQLSGGERQRVT
IARALIRQAPVLLVDEATAALDAENQAVIAQTLHSLHGRCTLVVIAHQLSTVAMADHIVV
LDAGQVVEQGTPATLRANGGHYARMLEQRHAANGWRIGAPRVEHD