Protein Info for PP_2586 in Pseudomonas putida KT2440

Annotation: putative amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 246 to 270 (25 residues), see Phobius details amino acids 296 to 323 (28 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 403 to 420 (18 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details PF00324: AA_permease" amino acids 36 to 417 (382 residues), 129.4 bits, see alignment E=1.6e-41 PF13520: AA_permease_2" amino acids 38 to 404 (367 residues), 116.8 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3130)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JR3 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PP_2586 putative amino acid transporter (Pseudomonas putida KT2440)
MHTTTSTAHSPAPHAPSQPGTSTGRFRKSMSMTALVLFGLAYMVPLAVFTTYGLVTQMTK
GHLPTAYLLTLAAMLLTAYSYGRMVQAHPYSGSVYTYTRKAFGSHIGFITGWTLLLDYIF
LPLLSYLLIGIYMSEYFPTIHAWVWVAGSIALVTFLNLIGIESITRVNWILVVVQLVFII
VFVALSILKLSGQAEPVSLLAPLHHDGFSVPLIMTGAAVLCLSFLGFDAVSTMAEETSNP
TYRIPVAILAVSLIGGLLFLVVSYCAQMVFPDWGSFADPDSASVDVMRRVGGELLVTAFT
ATYVAGCFASAMVSQASVSRVLFAMGRDGALPRAFGQLVTKKRVPATAILVVSLLSLIAL
VITLDTVANMISFGALFAFSAVNLAVVKHYLVDQKLRGCRNCLLYGAIPGLGFLSTLWLW
SSLTSLSFTIGLCWMGLGLLVLLGLTRALRVKLPELQMAE