Protein Info for PP_2550 in Pseudomonas putida KT2440

Annotation: putative transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF20772: TACO1_YebC_N" amino acids 7 to 70 (64 residues), 72.3 bits, see alignment E=3.7e-24 PF01709: Transcrip_reg" amino acids 78 to 233 (156 residues), 155.3 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 100% identical to Y2550_PSEPK: Probable transcriptional regulatory protein PP_2550 (PP_2550) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2550)

Predicted SEED Role

"FIG033889: YebC paralog in Betaproteobacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JU7 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PP_2550 putative transcriptional regulatory protein (Pseudomonas putida KT2440)
MGAQWKAKHRETAANAKGKIMGKLSKEIQIAAKSGADPDMNPRLRLAIVQAKKASMTRET
LDRAIRKGAGLDGDAVQYHAVSYEGFAPHQVPLIVECLTDNINRTVAQIRVLFRKGQLGA
SGSVAWDFNHVGLIEATPASADADPEMAAIEAGAQDFEEGEEEGSTLFITDTTDLDAVQK
ALPEHGFTVTAAKIGYTPKNPVSAASLSAEALAEVEAFLEAIDEHDDVQNVYVGLTE