Protein Info for PP_2516 in Pseudomonas putida KT2440

Annotation: HTH-type transcriptional regulator GalR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF00126: HTH_1" amino acids 10 to 68 (59 residues), 65.3 bits, see alignment E=3.8e-22 amino acids 102 to 158 (57 residues), 56.8 bits, see alignment E=1.7e-19 PF03466: LysR_substrate" amino acids 185 to 392 (208 residues), 110.9 bits, see alignment E=5.8e-36

Best Hits

Swiss-Prot: 100% identical to GALR_PSEPK: HTH-type transcriptional regulator GalR (galR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3202)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88JX7 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PP_2516 HTH-type transcriptional regulator GalR (Pseudomonas putida KT2440)
MIDVELPNLMQVRAFIRVAELGSVSRATEVLFRAQSVVTRAIAELEARFAVPLFERHANG
MRLTDYGECLLPRAQRVLAELDGVPSLLGTAQGEPLYLFQARRLQVFVKLCETRHMQTVA
RHFGLSQPAVSAALKVLEGGCGQPLFVRTSRGLQPTVASRDILFPIRRALNELRLLDSDL
SAMQGTLRGVVHVGALPLGRSRILPDAILRFTAQHPQVRVVTNESPFDLLATELRVGDVD
FVLGALRPHDYASDLVGEPLINEEMVVLARRGHPLLHTHLTLKGVHQARWVLPRAGSPAR
QLLDNCFAAAGLTAPWPVVESADLAVIRGLLVRSDMLAAVSAHQLAYEIASGELQRLPLA
LPGTARAIGLMQRSGCLQSPAAVALMACIRQVITEQA