Protein Info for PP_2472 in Pseudomonas putida KT2440

Annotation: putative transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 PF13411: MerR_1" amino acids 19 to 87 (69 residues), 72.5 bits, see alignment E=2.6e-24 PF00376: MerR" amino acids 20 to 57 (38 residues), 41.3 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppg:PputGB1_3474)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K21 at UniProt or InterPro

Protein Sequence (118 amino acids)

>PP_2472 putative transcriptional regulator, MerR family (Pseudomonas putida KT2440)
MLEPSHNDELPPIPGKRYFTIGEVSELCAVKPHVLRYWEQEFDQLNPVKRRGNRRYYQRQ
DVLMIRQIRALLYDQGFTIGGARLRLSSDEAKDESSQYKQLIRQMIVELEDVLVVLKK