Protein Info for PP_2457 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF00356: LacI" amino acids 3 to 48 (46 residues), 62.3 bits, see alignment 5.9e-21 PF00532: Peripla_BP_1" amino acids 60 to 318 (259 residues), 138.7 bits, see alignment E=5.8e-44 PF13407: Peripla_BP_4" amino acids 62 to 303 (242 residues), 68 bits, see alignment E=2e-22 PF13377: Peripla_BP_3" amino acids 169 to 329 (161 residues), 132.5 bits, see alignment E=3.3e-42

Best Hits

Swiss-Prot: 46% identical to PURR_PHOPR: HTH-type transcriptional repressor PurR (purR) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to ppu:PP_2457)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K35 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PP_2457 DNA-binding transcriptional repressor (Pseudomonas putida KT2440)
MATIKDVAALAGISYTTVSHVLNKTRPVSEQVRLKVEAAIIELDYVPSAVARSLKARSTA
TIGLLVPNSVNPYFAELARGIEDACERNGYCVILCNSDDNPQKQRSYLRVLLEKRIDGLV
VASVGQDDDLLQSLASVRTPMVIVDRELEGVDADLVRIDHEQGAYLATRHLLELGHRDVA
YIGGPAETGVTQLRLSGFRRAMAEAGAPVPGSRVLHCDFTSPGGHAAAAQVLEGKRPSAI
FAGNDMIGFGVLRAAAERNISVPGELSVIGFDDIELSRYVYPSLTTVGQSIRELGESAAS
LLLTRIATPRQGAAEQRIVAPRIVLRESTGPRPDLFNDYR