Protein Info for PP_2419 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function DUF1624 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 306 to 336 (31 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 14 to 242 (229 residues), 59 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2419)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K72 at UniProt or InterPro

Protein Sequence (386 amino acids)

>PP_2419 conserved membrane protein of unknown function DUF1624 family (Pseudomonas putida KT2440)
MTSAITTPTLITQRLQSIDALRGLVILFMLLDHARETFLLHRQVSDPMAIDTTEPALFFS
RTLAHLCAPVFVLLTGLSAWLYGEKHQGRGDVSAFLFKRGLFLVVLEFTLVNFAWTFQLP
PSVIYLQVIWAIGVSMIALSLLVWLPRAALLALGASIVAGHNLLDGLHFGVDSALHVPWA
ILHDRGWLAFSENLHLRTSYPVLPWIGVIALGYGLGPWFARGSDAGQRQQYLLVAGLLAL
LGFVLLRMFNGYGEAPWSGYPTFTQTLMSFFNITKYPPSLLFLTLGCGLLLLRAFERAGQ
ARWITALAVFGAAPMFFYLLHLYVLKLLYLACVALFGLNHGDYFGFDGIAAVWLGAVLLA
VALYLPVRGFARLKQRRRDIRWLKYF