Protein Info for PP_2418 in Pseudomonas putida KT2440

Annotation: putative cobalamin ABC transporter, periplasmic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 49 (49 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 74 to 338 (265 residues), 143.5 bits, see alignment E=3.6e-46

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to ppu:PP_2418)

Predicted SEED Role

"Cobalt ABC transporter, periplasmic substrate-binding component CbtJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K73 at UniProt or InterPro

Protein Sequence (364 amino acids)

>PP_2418 putative cobalamin ABC transporter, periplasmic (Pseudomonas putida KT2440)
MLPQPPAGARRCLSVRSSPELSDRRSPSMLLRFATLLAGLSLTGLAQAAATHYPLTVDNC
GKPQVFAQAPQRAVTIGQAGTELLYALGLGDKLAGTSLWFNNVLPEYQAVNAKVPRLADN
DPSFEAVVGKRPQLVAAQFEWMVGAQGVVATREQFDELKIPTYVLPSDCEGKDNLVGADG
TRLQAFQVDSIYKSVSELAEIFDVQDRGAALNAELQGRLDSARAQLAGKDLSATSALFWF
SSADLDIDPYVAGRQGVADFMLRTLGVRNVVESSEEWPSVGWETLAKANPTWLIIARMDR
RRFPADDYQKKLEFLRSDPVTRNMDAVKHDRIIILDADAMQAGIRLFRGVQTLSTAFASG
KAAP