Protein Info for PP_2416 in Pseudomonas putida KT2440

Annotation: putative Iron ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00005: ABC_tran" amino acids 27 to 176 (150 residues), 119.1 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 45% identical to HMUV_PSEE4: Hemin import ATP-binding protein HmuV (hmuV) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to ppu:PP_2416)

MetaCyc: 38% identical to ferric citrate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Cobalt ABC transporter, ATP-binding component CbtL"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K75 at UniProt or InterPro

Protein Sequence (262 amino acids)

>PP_2416 putative Iron ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MTAMAAVRIPPLACHGLGLQLAGNTVLSDIDLRVVAGETLGIVGPNGSGKSSLLKLLAGL
RKPACGSVQLLGEPLAQMPRRRVAQALALVEQQADTLDAISVFDAVALGRTPWLSALAPF
SRQDCAIVEQALADLDALHLRTRLWGSLSGGERQRVHIARALAQRPQVLLLDEPTNHLDI
QHQLSLLQQVQALPVTTLVALHDLNQALTCDRVAVLDKGRLVALGNPFEVLTPERLLSTF
GVHAHYLTDPFDGARILRFRAP