Protein Info for PP_2408 in Pseudomonas putida KT2440

Annotation: cobalt-zinc-cadmium resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02321: OEP" amino acids 42 to 211 (170 residues), 63.7 bits, see alignment E=9.5e-22 amino acids 248 to 409 (162 residues), 80.9 bits, see alignment E=5.1e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2408)

MetaCyc: 68% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Heavy metal RND efflux outer membrane protein, CzcC family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K83 at UniProt or InterPro

Protein Sequence (425 amino acids)

>PP_2408 cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
MLRPEDCFVPIPRKIALLCLLLASATDAQASQVLSLPQALTAAFAQNPELAAAGREIGIA
DGERRQAGLLPNPELAWEVEDTRRDTSTTTVTLSQPLELGGKRGARLAVAGAGQAIAQLD
LERQRNALRADVVQAFHAALRAQTALELAQQSQALTERGLRVVQGRVTAGQSSPVEATRA
QVQLAQAQAEVRRAKTQRSVAYQALARLTGSPLASFDRLQAANLSPGIAPGADTLLDQVE
KTAEWRLAAAQVERGDASLGAEKAQRIPNLTVSLGSQYSREDRERVNVVGLSMPLPLFDR
NQGNVLAAARRADQARDLRNAVALRLRSETRSAISQWEAAMQDVEAYDRTILPAAQQAVD
TATRGFEMGKFAFLDVLDAQRTLIEARGLYLEALASATDARAQVERIYGDLDGVSNKPNS
RSNND