Protein Info for PP_2403 in Pseudomonas putida KT2440

Annotation: Chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 109.4 bits, see alignment E=1.1e-35 PF00486: Trans_reg_C" amino acids 160 to 235 (76 residues), 76.7 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 38% identical to VIRG_AGRRH: Regulatory protein VirG (virG) from Agrobacterium rhizogenes

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to ppu:PP_2403)

Predicted SEED Role

"DNA-binding heavy metal response regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K88 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PP_2403 Chemotaxis protein CheY (Pseudomonas putida KT2440)
MEHVDHILIVDDDREIRELVGNYLKKNGLRTSIVADGRQMRAFLEANSVDLIVLDIMMPG
DDGLLLCRELRAGKHRNTPVLMLTARNDETDRIIGLEMGADDYLTKPFSARELLARINAV
LRRTRMLPPNLTISESSRLLGFGQWRLDTTARHLLDSEGTLVALSGAEYRLLRVFLDHPQ
RVLSREQLLNLTQGREADIFDRSIDLLVSRLRQRLGDDAREPSCIKTVRSEGYVFSLPVQ
LLESPS