Protein Info for PP_2402 in Pseudomonas putida KT2440

Annotation: putative Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 150 to 170 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 324 to 427 (104 residues), 88.3 bits, see alignment E=4.7e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2402)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K89 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PP_2402 putative Sensor histidine kinase (Pseudomonas putida KT2440)
MKWPRTLASRLALIFFTGLVLAYGLSFGLQAYERYISSRSMMLSNLEQDVATSVAILDRL
PAAERAAWLPRLERRTYRYRLDQGLAGEAMPSSDPPMAAASIVKAIGSDYRLTFLEIPGP
NAHFQAHLKLADGAPLTIDVTPAPVPVARWLPVVLLIQLAVLLLCTWLAVRLAIGPLTRL
AQAVDNLDPDQPGVQLDESGPREVRYAAVAFNALQARIAAHLKERMQLLAAISHDLQTPI
TRMKLRVEVMDEGVERDKFGSDLDEMEHLVREGVAYARSMDSSTEATCRVNLDAFLDSLV
FDYQDSGAQVERHGSSDTLLETRPHALRRVLVNLVDNALKFAGAAELQVSREGSTTIIRV
LDNGPGIPVDELDEVLKPFYRVEGSRNRSTGGTGLGLAIAHQLIRAMGGRLTLSNREQGG
LCAQIELT