Protein Info for PP_2398 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function, UPF0276 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF05114: MbnB_TglH_ChrH" amino acids 8 to 268 (261 residues), 350.5 bits, see alignment E=2.7e-109

Best Hits

Swiss-Prot: 100% identical to Y2398_PSEPK: UPF0276 protein PP_2398 (PP_2398) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09930, hypothetical protein (inferred from 100% identity to ppu:PP_2398)

Predicted SEED Role

"FIG023677: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88K93 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PP_2398 conserved protein of unknown function, UPF0276 family (Pseudomonas putida KT2440)
MFPAMLNVGLGLRRGLLPELLAMEAGAVDFLECAPENWIAVGGAYGKGLAQLAERFAVTC
HGLSLSLGGSAPLDRHFLEQTRQFLDRYQVRLYSEHLSYCSDDGHLYDLMPIPFTDEAVR
HVAARIRQAQEQLERRIAVENISYYAAPYQAMSELDFIQAVLEEADCDLLLDVNNVYVNA
CNHGYDAQQFLAGLPQARVAGMHVAGHYDEAPDLKVDTHGAAVKEDVWALYASACARFGV
QPTVLERDFNYPPLAELLAETARMRAVQCAAGGQADE