Protein Info for PP_2366 in Pseudomonas putida KT2440

Annotation: fosmidomycin efflux system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 236 to 263 (28 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 325 to 347 (23 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 281 (243 residues), 94.7 bits, see alignment E=2.7e-31 amino acids 243 to 414 (172 residues), 57.7 bits, see alignment E=5.1e-20

Best Hits

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 100% identity to ppu:PP_2366)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KC4 at UniProt or InterPro

Protein Sequence (420 amino acids)

>PP_2366 fosmidomycin efflux system (Pseudomonas putida KT2440)
MFPCPRRTLPMTTSAASVAAATPADQPQGFVVRIVGAAAFAHLLNDLIQAVLPSIYPMLK
SDFALSFAQIGWIALVYQVTASLLQPWVGMFTDKHPQPYLLPAGMLVTLVGIALLAFAGN
YEMLLVAAAVVGVGSATFHPEASRVARMASGGRFGTAQSTFQVGGNTGSALGPLLTAAII
IPHGQPAIAWFMLAAALAVLVLLRVTGWSVRHGQARLKTFAGQQAPGLSQGAMWRAVAVI
AVLMFAKFVYIASFTNFFTFYLIEHFGLSVQHSQLYLFVFLAAVALGTFAGGPVGDRIGR
KAVIWVSFLGVAPFALALPHANLAWTAVLAVAIGLVMSSAFAALVVYAQEAVPGRVGMVS
GVMFGLMFGISGVGAAALGALADRHGIEWVYQAIAFLPLLGLATALLPATRSQARPGRCC