Protein Info for PP_2337 in Pseudomonas putida KT2440

Annotation: aconitate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 318 to 336 (19 residues), see Phobius details TIGR02334: probable AcnD-accessory protein PrpF" amino acids 4 to 396 (393 residues), 772 bits, see alignment E=5.1e-237 PF04303: PrpF" amino acids 6 to 392 (387 residues), 652 bits, see alignment E=1.4e-200

Best Hits

Swiss-Prot: 84% identical to PRPF_CUPNE: 2-methyl-aconitate isomerase from Cupriavidus necator

KEGG orthology group: K09788, hypothetical protein (inferred from 100% identity to ppu:PP_2337)

Predicted SEED Role

"2-methylaconitate cis-trans isomerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KF3 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PP_2337 aconitate isomerase (Pseudomonas putida KT2440)
MSHVPQIKIPATYIRGGTSKGVFFRLQDLPEQAQIPGPARDALLLRVIGSPDPYGKQIDG
MGGATSSTSKTVILSQSIKPEHDVDYLFGQVSIDKAFVDWSGNCGNLSAAVGSFAISSGL
VDPARVPRNGIATVRIWQANIGKTIIAHVPITEGEVQETGDFELDGVTFPAAEVQLEFLD
PAADEDGGGGAMFPTGNLVDDLEVPGVGTFKATLINAGIPTIFVNAADIGYTGTELQDAI
NGDPQALLRFETIRAYGAVRMGLIDNVDQAAGRQHTPKVAFVAPPSTYTASSGKAVPAGE
IDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVG
AEARQVNGEWTVTKAIMSRSARVLMEGWVRVPGDSF