Protein Info for PP_2335 in Pseudomonas putida KT2440

Annotation: methylcitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00285: Citrate_synt" amino acids 11 to 358 (348 residues), 433.4 bits, see alignment E=3.3e-134 TIGR01800: 2-methylcitrate synthase/citrate synthase II" amino acids 11 to 375 (365 residues), 521.5 bits, see alignment E=5.1e-161

Best Hits

Swiss-Prot: 74% identical to PRPC_SHEON: 2-methylcitrate synthase (prpC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01659, 2-methylcitrate synthase [EC: 2.3.3.5] (inferred from 99% identity to ppg:PputGB1_1936)

MetaCyc: 54% identical to 2-methylcitrate synthase (Escherichia coli K-12 substr. MG1655)
2-methylcitrate synthase. [EC: 2.3.3.5]

Predicted SEED Role

"2-methylcitrate synthase (EC 2.3.3.5)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 2.3.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KF5 at UniProt or InterPro

Protein Sequence (375 amino acids)

>PP_2335 methylcitrate synthase (Pseudomonas putida KT2440)
MAEAKVLSGAGLRGQVAGQTALSTVGQAGAGLTYRGYDVRDLAAGAEFEEVAYLLLYGEL
PTQAELADYKRKLKGLRDLPQALKEVLERIPRDAHPMDVMRTGCSVLGTLEPELTFEAQR
DKTDRLLALFPAVMCYWYRFTHHGVRIDCTTDEDTLGGHFLHLLHGKKPSELHVKVMNVS
LILYAEHEFNASTFTARVCASTLSDLYSCVTAAIGSLRGPLHGGANEAAMELIERFQSPQ
EATAELLRMLERKDKIMGFGHAIYKESDPRNEVIKGWSKQLADEVGDKVLYPVSEAIDKT
MWEQKRLFPNADFYHASAYHFMGIPTKLFTPIFVCSRLTGWAAHVFEQRANNRIIRPSAE
YVGVEQRQFVPIEQR