Protein Info for PP_2299 in Pseudomonas putida KT2440

Annotation: Trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF05697: Trigger_N" amino acids 7 to 149 (143 residues), 148.8 bits, see alignment E=2.1e-47 TIGR00115: trigger factor" amino acids 17 to 416 (400 residues), 469.4 bits, see alignment E=4.7e-145 PF00254: FKBP_C" amino acids 162 to 243 (82 residues), 62.7 bits, see alignment E=5.1e-21 PF05698: Trigger_C" amino acids 268 to 417 (150 residues), 129 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 100% identical to TIG_PSEPK: Trigger factor (tig) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to ppu:PP_2299)

MetaCyc: 50% identical to trigger factor (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KJ1 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_2299 Trigger factor (Pseudomonas putida KT2440)
MQRGISMQVSVENTSALERRMTIAVPAERVENEVNKRLQQTAKRAKIAGFRPGKVPMTVI
RQRFEADARQEAFGDLVQASFYEAIVEQKLNPAGAPAVEPKSFEKGKDLEFVAIFEVFPE
FTVAGLESIKVERLSAEVADSDLDNMLEVLRKQNTRFEAVERAAQNDDQVNIDFVGKVDG
EAFAGGSAKGTLLVLGSGRMIPGFEEGLVGAKAGEERVVNVTFPEDYQNLDLAGKAAEFT
ITVNSVSAPVLPELNEEFFAQFGIKESTLEGFRAEVRKNMERELRQAIKTKVKNQVMDGL
LAANPIEVPKALLENEVNRLRVQAVQQFGGNIKPEQLPVELFEEQAKRRVVLGLIVAEVV
KQFELKPDDAKVREMIEEMASAYQEPEQVIAWYYKNDQQLNEVRSVVLEEQVVDTVLQKA
TVTDKSVSYEEAVKPAEAPAAAE