Protein Info for PP_2293 in Pseudomonas putida KT2440

Annotation: DNA maturase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 PF03237: Terminase_6N" amino acids 54 to 170 (117 residues), 24.9 bits, see alignment E=1.5e-09 PF22530: Terminase-T7_RNaseH-like" amino acids 354 to 461 (108 residues), 138.8 bits, see alignment E=8.2e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2293)

Predicted SEED Role

"Phage DNA packaging"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KJ7 at UniProt or InterPro

Protein Sequence (562 amino acids)

>PP_2293 DNA maturase B (Pseudomonas putida KT2440)
MTDRVKVHPAQEDFRKFIYLVWKHLNLPEPTPVQYDIARYLQHGPRRCVIEAFRGVGKSW
VTAAFVCWLLWRNPQLRILVVSASSARADAFSSFVKRLIHEMPLLQHLKPGPDQIDKMVA
FEVAPALPDQSPSVKSVGIMGQITGSRADIIIADDIEIPNNSATQMMRDKLSEAVKEFDA
ILKPLQSARIIYLGTPQCEMSLYNRLPERGYEIRVWPALYPTLQKVPHYKGSLAPFITQA
MEADPTLSGKPTDPRRFDEKDLMERMASYGRAGFALQFMLDTSLSDGDKFPLKVQDLMVM
NLNPIMAHVKLAWAASPELCINDMPTVALTGDRFYRPMWHASEMSEYTGCVMAIDPSGRG
QDETGYAVVKVLMGNLFLVAAGGLRGGYSDETLETLAKIAKAHQANHIIIEANFGDGMYT
KLFQPILQKHHRCLVEEVKHSQQKEQRIIDTLEPVLTQHRLIVDQKLIERDFESAHADIK
YSLFYQLTRLTRDRGALSHDDRLDALAMAVAYWVGHMARDNDKAVQEMRTRNMDAELKKF
MGHVLGCSQHKKGWMGGNAAAR