Protein Info for PP_2270 in Pseudomonas putida KT2440

Annotation: putative DNA primase/helicase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF21268: Helic-prim_T7_N" amino acids 7 to 65 (59 residues), 77 bits, see alignment E=2.7e-25 PF13662: Toprim_4" amino acids 84 to 162 (79 residues), 27.6 bits, see alignment E=6.7e-10 PF13155: Toprim_2" amino acids 86 to 174 (89 residues), 52 bits, see alignment E=1.9e-17 PF03796: DnaB_C" amino acids 215 to 388 (174 residues), 41.1 bits, see alignment E=3.6e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2270)

Predicted SEED Role

"DNA primase/helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KM0 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PP_2270 putative DNA primase/helicase protein (Pseudomonas putida KT2440)
MEGLISGEFKPLMKRKLTLETCRKFGYFVSEVRGRLVQVAPYFDNSGVMVAQKLRDQDKG
FAILGDGAKLTLFGQNLWASGGKKIVVTEGELDAMSVSQVQNNKWPVVSLPNGAPAARKA
IQRNIEYLESFEEVILMFDMDEPGREAAQECAELFSPGKCKIATLSMKDANELLVAGREQ
EIVTAIWNAKLYRPDGVVNVRDLLEEIRKALVMGLPWFLDPLTQLTYGRRYGEVYGLGAG
TGVGKTDFLTQQIAYDIQVLGERVGTIFLEQKPTETAKRVAGKIAGKRFHVPKDTAGWTD
EELDAAVDALGENLVMYDAFGETEWDIVKRKVRYMAVSEGIKLIYIDHLTAMADTADEKG
SLEQIMKEMAGLANELGIIITFISHLTTPEGKPHEEGGRVTIRHFKGSRAIGFWSYFMFG
LERDQQAEDPVVRQTTTFRILKDRYTGQATGEVLYLAYDRDTGLLSLTEAPEPSSPFKDE
SEF