Protein Info for PP_2258 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 TIGR00229: PAS domain S-box protein" amino acids 4 to 120 (117 residues), 58.9 bits, see alignment E=5.6e-20 PF08448: PAS_4" amino acids 12 to 119 (108 residues), 30 bits, see alignment E=1.8e-10 PF13426: PAS_9" amino acids 13 to 116 (104 residues), 54.1 bits, see alignment E=5.9e-18 PF13188: PAS_8" amino acids 13 to 49 (37 residues), 20.5 bits, see alignment 1.2e-07 PF00989: PAS" amino acids 14 to 99 (86 residues), 36.1 bits, see alignment E=2.1e-12 PF08447: PAS_3" amino acids 25 to 110 (86 residues), 44.1 bits, see alignment E=7.2e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 124 to 288 (165 residues), 145.9 bits, see alignment E=9.2e-47 PF00990: GGDEF" amino acids 130 to 285 (156 residues), 164.6 bits, see alignment E=5.9e-52 PF00563: EAL" amino acids 306 to 540 (235 residues), 242 bits, see alignment E=2.1e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2258)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KN2 at UniProt or InterPro

Protein Sequence (562 amino acids)

>PP_2258 Sensory box protein (Pseudomonas putida KT2440)
MDDNYRAAVDAAAIFSETDLRGNITYVNQQFCSISGYSREELLGANHRILNSGLHEPTFF
VGMWRALVAGRVWKGEICNRSKDGSLYWVDSTMVPLVDPLTGQVRKYVSIRFDVTEKRQL
LHTLQWRVGHDVLTGLPNRAYLSDLLNQALAYSRCEGISLAVCMLDLDGFKAVNDGYGHA
VGDLLLVEVAQRLKSILRGGDAVARLSGDEFVLILRDVDDEHQLHAALQRVLRALAAPCV
VREHTLSLSASIGVTLYPQDDEDADTLVRHADQAMYVAKQRGRNRYHLFDVSQEQELKAT
HQTVARVRRALRNGELCLYYQPKVNLRTGKVLGFEGLLRWQRPGRGVVPPGDFLPWVEQT
DLIVEIGEWVIGQALSQLQAWQRQGQPWSLSVNIAARHLQRSDFAERLQQLLAAYPAVDP
ALLDLEIVESVAIDNLQHVSRCLDACRALGVRFSLDDFGTGYSSLSYLKRLPTQTIKIDQ
SFVRDILHDQDDLALTEAVIGLARAFGREVIAEGLESVEHGRVLMGLGCELAQGYCIARP
MPASDVQAWAQAYQQPVQWRDP