Protein Info for PP_2249 in Pseudomonas putida KT2440

Annotation: Methyl-accepting chemotaxis protein PctB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details PF02743: dCache_1" amino acids 49 to 273 (225 residues), 96.5 bits, see alignment E=3.8e-31 PF22673: MCP-like_PDC_1" amino acids 111 to 193 (83 residues), 44.8 bits, see alignment E=3.2e-15 PF00672: HAMP" amino acids 314 to 363 (50 residues), 48.1 bits, see alignment 2.3e-16 PF00015: MCPsignal" amino acids 426 to 608 (183 residues), 146.8 bits, see alignment E=1.2e-46

Best Hits

Swiss-Prot: 100% identical to MCPA_PSEPK: Methyl-accepting chemotaxis protein McpA (mcpA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ppu:PP_2249)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KP1 at UniProt or InterPro

Protein Sequence (643 amino acids)

>PP_2249 Methyl-accepting chemotaxis protein PctB (Pseudomonas putida KT2440)
MSALRPPLIGSRSRNMNLKFRHKILLSACGVVVLAFALFTLYNDYLQRNTIRQNIEASVQ
QSGALTASSVQNWMSGRILVLENLAQDIGQQGAGDTLAGLIEQPSYTRNFLFTYLGQANG
EFTQRPDAQMPAGYDPRQRPWYGAAANAGQTVLTAPYQGAVGGLMVTIATPVKSKRNGEL
IGVVGGDVTLDTLVEIINSVDFGGIGHAFLADANGQVIVSPNKDQVMKNLKDIYPGSNLR
VAAGMQDVTLDGQDRIISFAPVAGLPSAQWYIGLSIDRDKAYAALSQFRTSAIIAMLIAV
AAIAGLLGLLIPVLMSPLTTMGRAMRDIAEGEGDLTRRLAVQNKDEFGELATSFNRFVER
IHASISEVSSATRLVHDLSEKVVSASNASIIGSEEQSMRTNSVAAAINELGAATQEIARN
AADASQHASGASEQAHGGREVVEEAISAMTALSQRISESCAQIETLNASTDEIGKILDVI
KGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAEEIHRMITSLQVGS
REAVHTMNTSQVSSEQTVQVANQAGERLASVTQRIGEIDGMNQSVATATEEQTAVVESLN
LDITQINALNQQGVENLNETLRHCDQLAQQAGRLKQLVGSFRI