Protein Info for PP_2242 in Pseudomonas putida KT2440

Annotation: ferric enterobactin transport system outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 744 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01783: TonB-dependent siderophore receptor" amino acids 66 to 744 (679 residues), 272.7 bits, see alignment E=3.9e-85 PF07715: Plug" amino acids 66 to 179 (114 residues), 90.6 bits, see alignment E=1.4e-29 PF00593: TonB_dep_Rec_b-barrel" amino acids 280 to 710 (431 residues), 206.5 bits, see alignment E=2.2e-64 PF14905: OMP_b-brl_3" amino acids 468 to 731 (264 residues), 47.6 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_2242)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KP8 at UniProt or InterPro

Protein Sequence (744 amino acids)

>PP_2242 ferric enterobactin transport system outer membrane subunit (Pseudomonas putida KT2440)
MQCRTSPNSLALAFVALASPSMLATAAESEERRAGEVLEVPVADNALVIQDTLITAEREA
RQALGTSIITAEDIKRHPPANDLSDIIRREPGVNLTGNSASGARGNNRQIDLRGMGPENT
LILIDGKPSSARNAVRYGWNGDRDTRGETNWVPAEAVERIEILRGPAAARYGSGAMGGVV
NIITKRPSDELKGSVSLYTQLPEDSAEGASRRANFNLGGGLTDNLGFRLYGGLAKTDADD
LDINAGHATSALVAGREGVRNKDINGLLSWKLNDEHRLEASAGYSRQGNIFAGDTMNSNG
GGDVDFVSSLYGHETNVMQRSTYDLTHLGDFTWGTSKTTLAYEYVRNWRLNEGLAGRTEG
APSNEGGAMSRLRNTRLSSEVNLPFAMGSTDHVLTLGGEYLYETLNDQGSLRPQSSDPTN
NDGLVGFDRSSSKMTARSYALFVEDNIIVGDTTLTPGLRFDHHETFGDNFSPSLNLSHKL
TEALSVKGGIARAYKVPNLYQSNPNYLLYSRGNGCSVQQTNNGGCYLQGNADLKPEISVN
KEIGLLYDRGTWRTSATYFRNDYKNKIIGDTDVLYTIGTGSRVTQWDNAGKARVEGVEGN
FFIELAPNLDWNTNLTWMLDNDNRETGEPLSVIPEYTVNTSLDWRATEQLSFQLAGTYFG
KQKSPTYDYRTQQDYDKTAQQDVEAYGLVDVSAGYKFNANYDVRVGVNNVFDKQILRGGN
ASSSGANTYNQPGRAVFAALNINF