Protein Info for PP_2236 in Pseudomonas putida KT2440

Annotation: putative hydrolase of the alpha/beta superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF12146: Hydrolase_4" amino acids 31 to 140 (110 residues), 33.3 bits, see alignment E=1.2e-11 PF12697: Abhydrolase_6" amino acids 31 to 189 (159 residues), 36.3 bits, see alignment E=3.3e-12 PF00326: Peptidase_S9" amino acids 53 to 239 (187 residues), 47.3 bits, see alignment E=6.7e-16 PF05728: UPF0227" amino acids 79 to 220 (142 residues), 22.7 bits, see alignment E=2.9e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 100% identity to ppu:PP_2236)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KQ4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PP_2236 putative hydrolase of the alpha/beta superfamily (Pseudomonas putida KT2440)
MAIQSETVELQVENDRIAGTLVSPGTKMPGILFVHGWGGSQQRDLARARHITGLGCVCMT
FDLRGHEKTESQRLTVTREQNLQDLLVAYDRLVSHPAVDSSAIAIIGSSYGGYLATLLTR
ERPVRWLALRVPAMYWDDEWGSPKQTLDRQRLNAYRQRPLGPTDNRALAACAEFGGDVLL
VESEQDDYVPHSTLMNYRSAFVNAHSLTHRIVDGADHALSSEQSQKAYSSLLAAWISEMV
IGARLDRYPHYAPWYA