Protein Info for PP_2231 in Pseudomonas putida KT2440

Annotation: putative permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00892: EamA" amino acids 20 to 147 (128 residues), 47.9 bits, see alignment E=8.7e-17 amino acids 160 to 289 (130 residues), 46.8 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_3509)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KQ9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PP_2231 putative permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas putida KT2440)
MNQPSSKPTPAVTFRLSKAELVLVFITMLWGGTFLLVHNVMTVSGPMFFVGLRFAAAALF
VGVVSARALPGLTFTELKAGMLIGVSIMLGYGLQTMGLQTISSSQSAFITALYVPFVPLL
QWLVLGRRPGLMPSMGICLAFIGLMLLAGPEGGSLRFSEGELVTLISAVAIAGEIILISR
YAGQVDVRRVTVVQLATASLLAFLMIVPTQERIPDFSWLLLASAVGLGAMSAVIQVAMNW
AQKSVSPTRATLIYAGEPVWAGIVGRLAGERLPGVALLGGLLIVVAVVVSELKVRRPRET
VETRDVQNPGERQAGL