Protein Info for PP_2217 in Pseudomonas putida KT2440

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to ECHH_RHIME: Probable enoyl-CoA hydratase (fadB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to ppg:PputGB1_1843)

MetaCyc: 64% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

oleate β-oxidation (30/35 steps found)
superpathway of phenylethylamine degradation (11/11 steps found)
phenylacetate degradation I (aerobic) (9/9 steps found)
superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
adipate degradation (5/5 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
β-alanine biosynthesis II (5/6 steps found)
valproate β-oxidation (7/9 steps found)
adipate biosynthesis (4/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
L-valine degradation I (6/8 steps found)
fatty acid β-oxidation I (generic) (5/7 steps found)
2-methyl-branched fatty acid β-oxidation (10/14 steps found)
acrylate degradation II (2/3 steps found)
acrylate degradation I (3/5 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
propanoyl-CoA degradation II (3/5 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
benzoyl-CoA degradation I (aerobic) (3/7 steps found)
3-phenylpropanoate degradation (4/10 steps found)
3-hydroxypropanoate cycle (6/13 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
glyoxylate assimilation (5/13 steps found)
superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KS2 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PP_2217 enoyl-CoA hydratase (Pseudomonas putida KT2440)
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR