Protein Info for PP_2205 in Pseudomonas putida KT2440

Annotation: copper resistance protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 3 to 572 (570 residues), 904.7 bits, see alignment E=2.6e-276 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 6 to 33 (28 residues), 19.7 bits, see alignment (E = 7.9e-08) PF07732: Cu-oxidase_3" amino acids 49 to 159 (111 residues), 132.6 bits, see alignment E=1.2e-42 amino acids 486 to 567 (82 residues), 25.5 bits, see alignment E=1.7e-09 PF00394: Cu-oxidase" amino acids 227 to 332 (106 residues), 87.1 bits, see alignment E=2.1e-28 PF07731: Cu-oxidase_2" amino acids 455 to 573 (119 residues), 104.1 bits, see alignment E=7.8e-34

Best Hits

Swiss-Prot: 69% identical to COPA_PSESM: Copper resistance protein A homolog (copA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2205)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KT4 at UniProt or InterPro

Protein Sequence (574 amino acids)

>PP_2205 copper resistance protein A (Pseudomonas putida KT2440)
MLRNPSRRTFVKGLGAASTLAGLGLWRPLVQAAEGRDLAGQHFELFIGQTPVNITGRPRT
ALTVNNSLPGPLLRWREGDTVTLRVRNRLAQDTSIHWHGIILPANMDGVPGLSFAGIEPG
GDYLYQFTLRQSGTYWYHSHSGLQEQAGVYGAIVIEPREPETHRYQRDHVLLFSDWSDQA
PEHLMATLKTQSDAYNFHKRTVGDFIDDVAENGWSATVAERTAWARMRMSPTDLADISAA
TYTYLLNGQPPQGNFTCLFQPGETVRLRLINASAMTYFDFRIPGLKLTVIAADGLPVTPV
SVDELRIAVAETYDVLVTVGDQPAYTLFAQSMDRTGFARGTLARAAGLQAPVPAPDPRPV
LSMEDMGHGGMDAMAGMDHRNPQGMNHGSMAGMDHAAMSAMQQHPISETDNPLVDMQTMA
PRPNLADPGIGLRDNGRRVLTYADLRSPYPDPDGRPPSRDIELHLTGHMERFAWSFDGIK
FSDAEPLRLTYGERVRITLVNDTMMTHPIHLHGMWSDLEDEHGQFLVRKHTVDIPPGSRR
TYRVTADALGRWAYHCHLLYHMETGMLREVRVDE