Protein Info for PP_2193 in Pseudomonas putida KT2440

Annotation: Outer membrane ferric siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 817 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF07660: STN" amino acids 79 to 129 (51 residues), 48.5 bits, see alignment 9e-17 PF07715: Plug" amino acids 154 to 256 (103 residues), 68 bits, see alignment E=1.4e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 155 to 815 (661 residues), 267.9 bits, see alignment E=1.1e-83 PF00593: TonB_dep_Rec_b-barrel" amino acids 348 to 773 (426 residues), 118.2 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2193)

Predicted SEED Role

"Aerobactin siderophore receptor IutA @ Iron siderophore receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KU6 at UniProt or InterPro

Protein Sequence (817 amino acids)

>PP_2193 Outer membrane ferric siderophore receptor (Pseudomonas putida KT2440)
MSGSSFVPLMLKPLHRRRGSFHHALMSCSAVALLLGPLHAGAATAAEQTQMQARQVQLDL
PAQPLDQALTTFADQAGLHLLYTTGDVAGQVSPALQGNYSVEQALQQLLAGSGMSWQFSE
ARTVTLRKAEAAPQAVNLKPIEVSVASRTSTAISEIPGTVWVVDQQQLREQIDSGVSLKE
AIGKLVPGLDLAPEGRTNYGQNMRGRNVLVMIDGVSQNSSRGLSRQFDSISPFNVERVEV
LSGASAIYGGGATGGIINIVTKKGEPGPARFETQLGASSGFNNSDDLATRFAQSVSGGNE
RVNARLGISGEQNEAFYDGAGDQIFIDNTQTDLQYNRTIDVLGTLGLQLNDQQSLDLLAQ
YYDSGNHGSTGIYFPNLNYNAPSDLEDAELRSGYSSDLEPRTRRLLLNANYHHTDVLGQD
FYLQASYRKEDDNFYPFPYYNRATPTGSRGVYFAASQQNFEVTSLKGLFAKQWDTLKLTY
GVDLDRERFNAEQTTFNAQTSSESGGLELEKDSKADRYPSYRVDGVSVYAQLDWHATDNL
TLSGGARRQQMDVDVSDFKGVPGGSNDYQVNLFNVGAIYDFKNGHQVWSNYGEGFDLPDP
AKYYGKPGLSVADNPLAGIKSRQVELGWRYADLDWDAQAALYYIWSDKIINVDSQTLTID
VEEQKSRDFGFEGALTRHFQTGWEAGGTLHMTRSEEEAEDGGWIKRDARYASLSKATAFV
GWKGDGRSARLQANHAFSLKDDADHEIDGYTTFDLLGSQDTGFGTFSAGIQNLLDKQYST
VWGQRATLFYSPTYGPAYLYDYQGRGRTYTLSWSMAY