Protein Info for PP_2184 in Pseudomonas putida KT2440

Annotation: putative Formate dehydrogenase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 206 to 220 (15 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details PF01512: Complex1_51K" amino acids 151 to 321 (171 residues), 154.6 bits, see alignment E=1.9e-49 PF10589: NADH_4Fe-4S" amino acids 433 to 516 (84 residues), 83 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to ppu:PP_2184)

Predicted SEED Role

"NAD-dependent formate dehydrogenase beta subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KV5 at UniProt or InterPro

Protein Sequence (525 amino acids)

>PP_2184 putative Formate dehydrogenase, beta subunit (Pseudomonas putida KT2440)
MPGGLSMLKLYIPCDSVARAVGADQVAEALLREAERRQLPLDIQRTSSRGLYWLEPLIEC
DSAQGRLGFGPITPHDVPSLLDALAGEPGGHSLALGPVEEIPYLKTQQRLLFARAGITRP
LSLDDYRANGGFAGLEAAVALDGAEVVAAVLDSGLRGRGGAAFPAGIKWRTVRDAGAGQK
YVVCNADEGDSGTFADRMLMEGDPFLLIEGMIIAGLAVGADKGYIYVRSEYPDAIRVLDQ
AFAIARDAGYLGADVAGSGQAFDLEVRVGAGAYICGEETALLESIEGKRGIVRAKPPLPA
LQGLFGLPTLVHNVLTLASVPIILAKGAAFYRDFGMGRSLGTMPFQLAGNIRQGGLVERA
FGLTLRELVEGYGGGTASGRPLKAAQVGGPLGAWVPPSHFDTPLDYEAFAAVGAMLGHGG
VVVADDTLNMASMARFALQFCAEESCGKCTPCRIGSTRGMEVVDRLIASSDITERHDQAL
LLRDLCDTLQYGSLCAMGGMTAYPVASALKYFPADFGLTTTEAAQ