Protein Info for PP_2179 in Pseudomonas putida KT2440

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 5 to 223 (219 residues), 258.5 bits, E=5.9e-81
• PF00117: GATase
  • amino acids 95 to 231 (137 residues), 46.5 bits, E=3.6e-16

Best Hits

Swiss-Prot: 44% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to ppu:PP_2179)

MetaCyc: 44% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

• superpathway of L-arginine and L-ornithine degradation (11/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (9/11 steps found)
• superpathway of ornithine degradation (6/8 steps found)
• putrescine degradation II (3/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.94

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

See Q88KW0 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PP_2179 glutamine amidotransferase (Pseudomonas putida KT2440)
MPRVPVIGITACTSMIELHATQTISEKYARAAAKAACGLPIVIPSLGELMDSADILDVVD
GLIFTGSPSNIEPYHYNGPASAAGTHHDQLRDATTLPLMRAAIAAGVPVLGICRGFQEMN
VALGGTLHQKVHETGVFMDHREGKDEPLDKQYGPRHTLHVEPGGMLDRMGLPAIFDVNSI
HGQGIDVLAPGLRVEALAPDGLVEAISVESSKGFALGVQWHPEFQVMDNPHYLAIFQSFG
KACRHRSVLRQRLLLSA