Protein Info for PP_2179 in Pseudomonas putida KT2440

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF07722: Peptidase_C26" amino acids 5 to 223 (219 residues), 258.5 bits, see alignment E=5.9e-81 PF00117: GATase" amino acids 95 to 231 (137 residues), 45.2 bits, see alignment E=8.8e-16

Best Hits

Swiss-Prot: 44% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to ppu:PP_2179)

MetaCyc: 44% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.94

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KW0 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PP_2179 glutamine amidotransferase (Pseudomonas putida KT2440)
MPRVPVIGITACTSMIELHATQTISEKYARAAAKAACGLPIVIPSLGELMDSADILDVVD
GLIFTGSPSNIEPYHYNGPASAAGTHHDQLRDATTLPLMRAAIAAGVPVLGICRGFQEMN
VALGGTLHQKVHETGVFMDHREGKDEPLDKQYGPRHTLHVEPGGMLDRMGLPAIFDVNSI
HGQGIDVLAPGLRVEALAPDGLVEAISVESSKGFALGVQWHPEFQVMDNPHYLAIFQSFG
KACRHRSVLRQRLLLSA