Protein Info for PP_2160 in Pseudomonas putida KT2440

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR03138: queuine synthase" amino acids 5 to 276 (272 residues), 397.1 bits, see alignment E=2.3e-123 PF14819: QueF_N" amino acids 16 to 126 (111 residues), 148.6 bits, see alignment E=9.1e-48 PF14489: QueF" amino acids 190 to 263 (74 residues), 70.4 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 100% identical to QUEF_PSEPK: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 100% identity to ppu:PP_2160)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88KX9 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PP_2160 NADPH-dependent 7-cyano-7-deazaguanine reductase (Pseudomonas putida KT2440)
MHPAAEHSPLGKSSEYIATYSPEQLFPIPRTAKWAELGVTAQTLPWQGVDYWNCFELSWL
LPSGKPVVAIGEFAIPADSPNIIESKSFKLYLNSLNQTVFTSLGALQVCLEKDLSAAAGK
PVGVKVRTLAEVEAQGVVALPGQCIDALDVAISNYEQPQPELLRCNPERVVEETLHSHLL
KSNCPVTGQPDWGSVVVQYKGRALDHASLLTYLISFRQHADFHEQCVERIYLDLKNLLQP
EHLTVYARYVRRGGLDINPYRSTGPISPDNKRLVRQ