Protein Info for PP_2124 in Pseudomonas putida KT2440

Annotation: putative Glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF13579: Glyco_trans_4_4" amino acids 17 to 205 (189 residues), 65.4 bits, see alignment E=2e-21 PF13439: Glyco_transf_4" amino acids 17 to 210 (194 residues), 48.7 bits, see alignment E=2.2e-16 PF13692: Glyco_trans_1_4" amino acids 222 to 358 (137 residues), 81.6 bits, see alignment E=1.8e-26 PF00534: Glycos_transf_1" amino acids 222 to 372 (151 residues), 52.2 bits, see alignment E=1.4e-17 PF13524: Glyco_trans_1_2" amino acids 253 to 388 (136 residues), 44.7 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_2124)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L13 at UniProt or InterPro

Protein Sequence (415 amino acids)

>PP_2124 putative Glycosyl transferase (Pseudomonas putida KT2440)
MRILWTLPYLPWPTTSGHKTRQYHLLRALAQRGHRITLLVQSKIPLCDAAREALEPLLER
LIVLPRRPLHSPLNLLASPIIDYPMRAIINGLAPCLRHRFEQLLDEPWDVIQIEHSYSFQ
PFEKALQARRLPFMLSEHTLESVMGGACHDRLPLWLRPLNAFDRWRYRRWEHRVLRQPTE
LVAVSAHDAELIAQISGRPVNVVVNGVDCDFYQQVQPALHSQRLLFVGNFEYGANLEAIE
WALDDIMPKVWMSNPAVRLAIAGHAMPANWKLHWNDPRIEWFGYRPDLRELQRRSALFFA
PLRYAGGSKVKILEAMAAGLPVITTDKGVSGLTVNNGEHYLGSDDGDQLALLITQLLNQP
WRMSQLSDAGRQFARQRHDWSVAAQQLENVHIRLTQAAPDEAAPLASAWLGRSAK