Protein Info for PP_2119 in Pseudomonas putida KT2440

Annotation: putative ABC efflux transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 69 to 91 (23 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 8 to 584 (577 residues), 891.8 bits, see alignment E=1.1e-272 PF00664: ABC_membrane" amino acids 28 to 295 (268 residues), 175.9 bits, see alignment E=1.4e-55 PF00005: ABC_tran" amino acids 365 to 513 (149 residues), 123 bits, see alignment E=1.5e-39

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to ppu:PP_2119)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L18 at UniProt or InterPro

Protein Sequence (587 amino acids)

>PP_2119 putative ABC efflux transporter, permease/ATP-binding protein (Pseudomonas putida KT2440)
MPESVSLRQRRALRLAWQFVRPYRRQVLLALLALVVTAAITLSMGQGIRLLVDQGFMTRS
AHQLNQTIGLFLLLVLALAVGTFSRFYLVSWIGERCVADIRRAVFDHLIGLHPGFFEDNR
SSEIQSRLTADTTLLQSVIGSSLSMFLRNALMVIGGVVLLFITNPKLTSIVVVTLPLVLA
PILLFGRRVRSLSRQSQDRVADVGSYVAETLGQIKTVQAYNHQAHDRELFADTVEAAFTV
ARKRITQRAWLITLVIVLVLGAVGVMLWVGGMDVIAGRISAGELAAFVFYSLIVGSAFGT
LSEVIGELQRAAGAAERIAELLAARSAILPPDVAQVLPQPRASGHIELQQVVFAYPSRPT
VAAVDGLSLTIEPGQTVALVGPSGAGKSTLFDLLLRFYDPQQGRILLDGQPVTDFDPDQL
RRQFALVAQNPSLFRGTVEANIRYGRPEATLAEVEAAARGAHADEFIRQLPQGYQTPLGE
GGIGLSGGQRQRLAIARALLVDAPILLLDEATSALDAQSEYLIQQALPSLMAGRTTLVIA
HRLATVQHAERIAVIDQGRLVAVGTHRQLIEDSPLYARLAALQFTTG