Protein Info for PP_2117 in Pseudomonas putida KT2440

Annotation: Erythronate-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00389: 2-Hacid_dh" amino acids 7 to 277 (271 residues), 64.7 bits, see alignment E=1.1e-21 PF02826: 2-Hacid_dh_C" amino acids 110 to 255 (146 residues), 106.5 bits, see alignment E=1.7e-34 PF11890: DUF3410" amino acids 288 to 376 (89 residues), 86.9 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 100% identical to PDXB_PSEPK: Erythronate-4-phosphate dehydrogenase (pdxB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 100% identity to ppu:PP_2117)

MetaCyc: 46% identical to erythronate-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-phosphoerythronate dehydrogenase. [EC: 1.1.1.290]

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L20 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_2117 Erythronate-4-phosphate dehydrogenase (Pseudomonas putida KT2440)
MLIVADENIPLLDAFFQGFGEIRRYPGRSLDAASVKDADILLVRSVTKVDRQLLEGSRVR
FVGTCTIGTDHLDLDYFAEAGIHWSSAPGCNARGVVDYVLGSLLTLAELDGVALPERVYG
VVGAGEVGGRLVRVLHGLGWKVLVCDPLRQAAEGGDYVSLETILQQCDVISLHTPLQRGG
QHPTWHLLGQAQLAQLRPGAWLVNASRGPVVDNVALRELLLDREDVHAVLDVWEGEPQVD
LQLADLCTLATPHIAGYSLDGRQRGTARIYQALCRFLGVNEQVRLAELLPKPPLAQIELD
ASTDLSWALATLCRAVYDPRRDDADFRRSLSDDPQQQRAAFDQLRKQYPPRREIEGLAVR
LHGEAPQLAQLVSALGGVLV