Protein Info for PP_2116 in Pseudomonas putida KT2440

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 PF01206: TusA" amino acids 9 to 77 (69 residues), 77.2 bits, see alignment E=3.5e-26

Best Hits

Swiss-Prot: 100% identical to TUSA_PSEP1: Sulfur carrier protein TusA (tusA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K04085, tRNA 2-thiouridine synthesizing protein A [EC: 2.8.1.-] (inferred from 99% identity to ppg:PputGB1_1656)

MetaCyc: 53% identical to sulfur transfer protein TusA (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L21 at UniProt or InterPro

Protein Sequence (80 amino acids)

>PP_2116 sulfurtransferase (Pseudomonas putida KT2440)
MTDFTPDAILDATGLNCPEPVMMLHQHVRNLAAGGLLKVIATDPSTRRDIPKFCNFLGHE
LLQQQEDAGTFLYWIRKKAD