Protein Info for PP_2102 in Pseudomonas putida KT2440

Annotation: Deoxyguanosinetriphosphate triphosphohydrolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR01353: putative dGTPase" amino acids 24 to 435 (412 residues), 322.3 bits, see alignment E=3.3e-100 PF01966: HD" amino acids 61 to 124 (64 residues), 27 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 87% identical to DGTL2_PSEAB: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (PA14_24730) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 99% identity to ppg:PputGB1_1644)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L33 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PP_2102 Deoxyguanosinetriphosphate triphosphohydrolase-like protein (Pseudomonas putida KT2440)
MDWHTLLTRERLGKALYSADELGRSPFHKDHDRIIFSGAFRRLGRKTQVHPVSSNDHIHT
RLTHSLEVSCVGRSLGMRVGETLRDNLPDWCAPSDLGMIVQSACLAHDIGNPPFGHSGED
AIRHWFQQAAGRGWLDDMSDDERADFLNFEGNAQGFRVLTQLEYHQFDGGTRLTYATLGT
YLKYPWSARHADALGYKKHKFGSYQSELPLLEQIARKLGLPQLEHQRWARHPLVYLMEAA
DDICYALIDLEDGLEMELLQYAEVEALLLDLVGEDLPETYRQLGPRDSRRRKLAILRGKA
IEHLTNAAAHAFVEQQQALLAGQLPGDLVEHMHGPAKRCVLQAKDMARNKIFQDKRKTLH
EIGAYTTLEILLNTFCGAALEQHGGRTPSFKSRRVLDLIGNNAPDPHASLHSAFLRMIDF
IAGMTDSYASEMAREMTGRSSPA