Protein Info for PP_2092 in Pseudomonas putida KT2440

Annotation: Nitrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 21 to 355 (335 residues), 315.6 bits, see alignment E=2.3e-98 PF07690: MFS_1" amino acids 31 to 357 (327 residues), 156.2 bits, see alignment E=1.1e-49 PF13347: MFS_2" amino acids 156 to 327 (172 residues), 27.8 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 49% identical to NASA_BACSU: Nitrate transporter (nasA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to ppu:PP_2092)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L43 at UniProt or InterPro

Protein Sequence (411 amino acids)

>PP_2092 Nitrate transporter (Pseudomonas putida KT2440)
MYYRVRCSMSASFWKSGHVPTLFAAFLYFDLSFMVWYLLGPLAVQIAADLQLSAQQRGLM
VATPILAGAILRFAMGVLVDRLSPKTAGLIGQVVVIVALAAAWHLGVHSYEQALLLGVFL
GFAGASFAVSLPLASQWYPPQHQGKAMGIAGAGNSGTVFAALLAPALAAGFGWNNVFGFA
LIPLSLALVVFALLARNAPQRPKPKAMADYLKALGDRDSWWFMFFYSVTFGGFIGLASAL
PGYFSDQYGLSPVTAGYYTAACVFAGSLMRPLGGALADRFGGIRTLLGMYGVAAICIAAV
GFNLPSAAAALALFVSAMLGLGAGNGAVFQLVPQRFRQEIGVMTGLIGMAGGIGGFLLAA
GLGTIKQHTGDYQLGLWLFASLGLLAWFGLHGVKQRWRTTWGSAAVTAARV