Protein Info for PP_2089 in Pseudomonas putida KT2440

Annotation: Outer membrane porin F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05736: OprF" amino acids 1 to 179 (179 residues), 282.9 bits, see alignment E=1.7e-88 PF13505: OMP_b-brl" amino acids 14 to 176 (163 residues), 37.3 bits, see alignment E=5e-13 PF00691: OmpA" amino acids 238 to 333 (96 residues), 81.8 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 86% identical to PORF_PSESY: Outer membrane porin F (oprF) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 99% identity to ppg:PputGB1_1600)

Predicted SEED Role

"Major porin and structural outer membrane porin OprF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L46 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PP_2089 Outer membrane porin F (Pseudomonas putida KT2440)
MKLKNTLGLAIGSLVAATSIGAMAQGQGAVETEIFYKKEFFDSQRDFKNDGNLFGGSIGY
FLTDDVELRLGYDEVHNARGEDGKNIKGSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLG
QTGRGGRDHSTFANVGAGAKWYITDMFYARAGVEAQYNIDQGDTEWAPSVGVGLNFGGSP
KQAEAAPAPVAEVCSDSDNDGVCDNVDKCPDTPANVTVDADGCPAVAEVVRVELDVKFDF
DKSVVKPNSYGDIKNLADFMKQYPQTTTVVEGHTDSVGPDAYNQKLSERRANAVKQVLTQ
QYGVESSRVDSVGYGETRPVADNATEEGRAVNRRVEAQVEAQAK