Protein Info for PP_2084 in Pseudomonas putida KT2440

Annotation: Putative regulator of ribonuclease activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 TIGR01935: RraA family" amino acids 6 to 155 (150 residues), 240.5 bits, see alignment E=2.9e-76 PF03737: RraA-like" amino acids 6 to 154 (149 residues), 161.4 bits, see alignment E=9.2e-52

Best Hits

Swiss-Prot: 100% identical to RRAAH_PSEPK: Putative 4-hydroxy-4-methyl-2-oxoglutarate aldolase (PP_2084) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02553, regulator of ribonuclease activity A (inferred from 97% identity to pen:PSEEN1744)

Predicted SEED Role

"Ribonuclease E inhibitor RraA" in subsystem RNA processing and degradation, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L51 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PP_2084 Putative regulator of ribonuclease activity (Pseudomonas putida KT2440)
MQHYVTPDLCDAYPDLVQVLEPMFSNFGGRDSFGGQIVTIKCFEDNSLVKEQVELDGKGK
VLVVDGGGSLRRALLGDMLAEKAAKNGWEGLVIYGCVRDVDVLIQTDVGVQALASHPMKT
DKRGIGDLNVVVTFAGVTFRPGEYVYADNNGVLVSPKPLKMPE