Protein Info for PP_2073 in Pseudomonas putida KT2440

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00583: Acetyltransf_1" amino acids 69 to 145 (77 residues), 40.4 bits, see alignment E=5.1e-14 PF13508: Acetyltransf_7" amino acids 74 to 146 (73 residues), 48.4 bits, see alignment E=1.5e-16 PF13673: Acetyltransf_10" amino acids 75 to 150 (76 residues), 53.1 bits, see alignment E=5.2e-18

Best Hits

Swiss-Prot: 40% identical to YJAB_SALTY: Peptidyl-lysine N-acetyltransferase YjaB (yjaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to ppu:PP_2073)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L62 at UniProt or InterPro

Protein Sequence (171 amino acids)

>PP_2073 Acetyltransferase, GNAT family (Pseudomonas putida KT2440)
MMPTLAWPPLTGAHIRHQYTQDDTMIIRQGIAADYPQLLDIWLRAVRATHHFLQPSDIDA
LLPQLRDVYFPAVELWVAVDTDDQPLGFVGFNENHVEMLFVDPARHRQGIGRALLDFGRQ
SRSAMSVDVNEQNPQATAFYQHYGFVQTGRSPLDGEGRPFPLLHMSLPTRA