Protein Info for PP_2060 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional dual regulator - SoxR-reversible one-electron oxidation of its [2Fe-2S] cluster, NADPH-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR01950: redox-sensitive transcriptional activator SoxR" amino acids 9 to 148 (140 residues), 205.6 bits, see alignment E=1.3e-65 PF13411: MerR_1" amino acids 10 to 75 (66 residues), 52.3 bits, see alignment E=7.8e-18 PF00376: MerR" amino acids 10 to 46 (37 residues), 53.8 bits, see alignment E=2e-18 PF09278: MerR-DNA-bind" amino acids 51 to 116 (66 residues), 59.1 bits, see alignment E=8.3e-20

Best Hits

Swiss-Prot: 66% identical to SOXR_ECOLI: Redox-sensitive transcriptional activator SoxR (soxR) from Escherichia coli (strain K12)

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 100% identity to ppu:PP_2060)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88L75 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PP_2060 DNA-binding transcriptional dual regulator - SoxR-reversible one-electron oxidation of its [2Fe-2S] cluster, NADPH-dependent (Pseudomonas putida KT2440)
MAADNTRMLTVGEVAKRSGVAVSALHFYETKGLIASVRTAGNQRRYPSLVLRTLAIIKVA
QRTGIPLEEIKQAFSRYAPNSKLTAAQWSEMSTAWREDLNARIRTLEALRDSLDNCIGCG
CLSLEDCPLRNPEDVLGKEGTGARILEKKAR