Protein Info for PP_2028 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function containing tetratricopeptide (TPR) domain repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 310 to 336 (27 residues), see Phobius details PF13519: VWA_2" amino acids 96 to 188 (93 residues), 34.1 bits, see alignment E=5.5e-12 PF00515: TPR_1" amino acids 403 to 435 (33 residues), 35.5 bits, see alignment (E = 9.2e-13) PF07719: TPR_2" amino acids 403 to 435 (33 residues), 30.1 bits, see alignment (E = 4.9e-11)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to ppu:PP_2028)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LA7 at UniProt or InterPro

Protein Sequence (572 amino acids)

>PP_2028 conserved protein of unknown function containing tetratricopeptide (TPR) domain repeat (Pseudomonas putida KT2440)
MIDLWPQWLRPLWLLAVPVLGWLLYKLWHRRKRAGRWQMILPPAFHGVLLGGGSGSTSKL
PWVALGLAWLLVILALLGPSWQRLEESRQRPADPLVILLELTPQMLAEDSPPNRLEQARR
KILDLLEHRRDSQTALVVYAGSAHTLVPLSDDLATTRNLLEAIDPSIMPKPGQRADLAVQ
KGLALLAQSGLGQGRLLLVGSALSAAERQGITQALGRQGPSLLMLGIGSREGAPVRQANG
EYLKDDQGGILLPRLDSASLKGFISGTGGRYRHARIDDLDLRGLGLFDNPRSGRNDGQTL
QLDSWADQGYWLLIPLLLLAACAGRRGWLFCLPLLLALPQPGQAFELNDLWLRPDQQGQK
LLEQNRPASAARHFQNPQWRGMALYQAGDYAGAAEAFSQGDTAAAHYNRGNALARSGELE
AALDAYEQALERQPDLQAALDNQALVQQLLQQREAKAEEQPPGSDAQDTPGSETEGNSSS
ASSPAQGTPGDDQQASPEQPGESSSNSQAAPGNQAGSDDSVIQPPQRPVSTSLDGEQRQA
LEQWLREIPDNPAELLRRKFWYEQQLHQEKSQ