Protein Info for PP_2000 in Pseudomonas putida KT2440

Annotation: amidophosphoribosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 464 (463 residues), 537.4 bits, see alignment E=1.8e-165 PF13522: GATase_6" amino acids 65 to 200 (136 residues), 54.7 bits, see alignment E=1.7e-18 PF13537: GATase_7" amino acids 81 to 212 (132 residues), 40.3 bits, see alignment E=4.7e-14 PF00156: Pribosyltran" amino acids 274 to 393 (120 residues), 33.5 bits, see alignment E=3.7e-12

Best Hits

Swiss-Prot: 91% identical to PUR1_PSEAE: Amidophosphoribosyltransferase (purF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to ppf:Pput_3761)

MetaCyc: 64% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LD5 at UniProt or InterPro

Protein Sequence (501 amino acids)

>PP_2000 amidophosphoribosyl transferase (Pseudomonas putida KT2440)
MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTSHDGRLFLRKDNGLVRDVFQQRHM
QRLVGNIGIGHVRYPTAGSSTSAEAQPFYVNSPYGITLAHNGNLTNVEQLAKEIYESDLR
HVNTNSDSEVLLNVFAHELAVRGKLQPTEEDVFAAVSHVHSRCVGGYAVVAMITGYGIVG
FRDPHGIRPVVFGQRHTDEGVEYMIASESVALDVLGFTLIRDLAPGEAVYITEEGQLFTK
QCAESPKLQPCIFEHVYLARPDSIIDGVSVYKARLRMGEKLADKIMRERPDHDIDVVIPI
PDTSRTAALELANRLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQKLNAIELEFRGKN
VMLVDDSIVRGTTCKQIIQMAREAGAKNVYFCSAAPAVRYPNVYGIDMPSVHELIAHNRT
TEQVGELIGADWLVYQDLPDLIDSVGGGKIKIEQFDCAVFNGEYVTGDIDEAYLDRIEQA
RNDLAKVKNQAVSAIIDLYNN