Protein Info for PP_1994 in Pseudomonas putida KT2440

Annotation: tRNA pseudouridine (38-40)synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 20 to 257 (238 residues), 217.8 bits, see alignment E=8.1e-69 PF01416: PseudoU_synth_1" amino acids 26 to 121 (96 residues), 36 bits, see alignment E=4.2e-13 amino acids 161 to 263 (103 residues), 110.1 bits, see alignment E=3.9e-36

Best Hits

Swiss-Prot: 75% identical to TRUA_PSEAE: tRNA pseudouridine synthase A (truA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to ppf:Pput_3767)

MetaCyc: 57% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FW51 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PP_1994 tRNA pseudouridine (38-40)synthase (Pseudomonas putida KT2440)
MLLDIIDTATAESAAEGYSRIALGVEYKGARYRGWQRQASGVPSVQQALEQALSKVANEP
ISVVCAGRTDAGVHGCGQVVHFDTRAVRDERAWTMGTNFNLPHDISVVWSRPMPADFHAR
FKACARRYRYVIYNDPIRPAHLAEEVTWNHRPLDVDRMAEAAQYLLGTHDFSAFRASQCQ
AKSPIKHIYHLRVTRHGQMIVLDVRATAFLHHMVRNIAGVLMAIGAGERPVAWAREVLEG
RNRREGGVTAHPYGLYLVQVEYPEAFALPKRYIGPHFLSGYEALAD