Protein Info for PP_1987 in Pseudomonas putida KT2440

Annotation: Methlytransferase, UbiE/COQ5 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF05175: MTS" amino acids 35 to 117 (83 residues), 24.6 bits, see alignment E=8.1e-09 PF03141: Methyltransf_29" amino acids 37 to 142 (106 residues), 29.9 bits, see alignment E=1e-10 PF13489: Methyltransf_23" amino acids 39 to 193 (155 residues), 66.1 bits, see alignment E=1.5e-21 PF01209: Ubie_methyltran" amino acids 41 to 158 (118 residues), 64 bits, see alignment E=6.4e-21 PF13847: Methyltransf_31" amino acids 45 to 149 (105 residues), 77.9 bits, see alignment E=2.9e-25 PF03848: TehB" amino acids 46 to 149 (104 residues), 23.3 bits, see alignment E=1.8e-08 PF13649: Methyltransf_25" amino acids 48 to 141 (94 residues), 88.2 bits, see alignment E=2.2e-28 PF08241: Methyltransf_11" amino acids 49 to 145 (97 residues), 92.9 bits, see alignment E=7.4e-30 PF08242: Methyltransf_12" amino acids 49 to 142 (94 residues), 61.4 bits, see alignment E=5.1e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1987)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LE6 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PP_1987 Methlytransferase, UbiE/COQ5 family (Pseudomonas putida KT2440)
MTSTQHIDVVQRQFGEQASAYLSSAVHAQGSEFALLQAELAGQAHARVLDLGCGAGHVSF
HVAPLVAEVVAYDLSQSMLDVVASAAAERGLANITTERGAAERLPFADASFDFVFSRYSA
HHWSDLGLALREVRRVLKPGGVAAFIDVMSPGSPLLDTYLQTVEVLRDTSHVRDYSAAEW
QRQVSEAGLHVRSHTRQTLRLEWSTWVERMRTPEPMRVAIRQLQQAMGEEVRQYYQIEAD
GSFSTDVLVLWAER